Vultee Vengeance - utveckling, översikt och amerikansk service

Vultee Vengeance - utveckling, översikt och amerikansk service



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Vultee Vengeance - utveckling, översikt och amerikansk service

Vultee Vengeance var ett dykbombplan som ursprungligen köptes av fransmännen och som togs i produktion för RAF, men det nådde inte service förrän konceptet med den dedikerade dykbombaren hade diskrediterats. Den ursprungliga franska ordern var ganska överambitiös. Det krävde 300 flygplan, med leveranser som skulle börja i oktober 1940, men Vengeance gjorde inte sin första flygning förrän i mars 1941.

De dramatiska tyska segrarna i maj och juni 1940 fick Stuka dykbombaren att få ett fruktansvärt rykte när det svepte över slagfälten i Belgien och Frankrike. Med detta i åtanke beslutade den brittiska inköpskommissionen att leta efter en dykbombare i USA och fann att Vengeance var den enda tillgängliga. Den första kontrollen, för 200 flygplan, placerades den 3 juli 1940 och följdes av en andra order, för 100 flygplan, den 2 december 1940. En tredje order, för 400 flygplan, placerades i april 1942 och en fjärde, för 200 flygplan, i juni. Den 28 juni blev båda dessa order en del av utlåningsarrangemanget och Vengeance fick USAAF-beteckningen A-31.

Den första prototypen (RAF -serienummer AF745) kompletterades med dubbla fenor och roder, men efter taxeringsförsöken vägrade testpiloten att flyga den i den konfigurationen. Den fick sedan en enda fin och roder, liknande den som användes på Vultee Vanguard -jägaren, och som redan hade installerats på det andra flygplanet. AF745 gjorde sitt första flyg den 30 mars 1941.

Leveranserna av hämnden började tidigt 1942. Vid detta datum hade Stuka förlorat sitt fruktansvärda rykte, och det hade blivit klart att dykbombaren var mycket sårbar om den stod inför moderna stridsflygplan - tyskarna hade snart tvingats dra tillbaka typen från slaget om Storbritannien, och hämnden skulle ha varit mycket sårbar mot Bf 109 eller Fw 190.

Liksom många flygplan som inte behövs i Storbritannien skickades hämnden till Fjärran Östern, där den tjänstgjorde med RAF och Indian Air Force över Burma och med RAAF i Nya Guinea.

I februari 1943 beskrevs hämnden av generalmajor Davenport Johnson, chef för militära krav för USAAF, som 'ett lysande exempel på slöseri med material, människokraft och tid i produktionen av ett flygplan som detta kontor har försökt att eliminera i flera månader '. Produktionen av Vengeance överlevde tydligen bara 1943 eftersom det bidrog till produktionsmålet för 107 000 militära flygplan som skulle produceras under året. Den hade ett fruktansvärt rykte - de flesta piloter tyckte att det var svårt att flyga och en dålig dykbombare, även om mer erfarna piloter rapporterade att den var oskadlig och helt aerobatisk.

Beskrivning

The Vengeance var en tandem tvåsitsig, med en pilot och bakskytte. Modell 72 drivs av en 1,600 hk Wright GR-2600-A5B-5 radialmotor med cyklon och var beväpnad med sex 0,30 tum kanoner, två flexibelt monterade kanoner i den bakre cockpiten och fyra fasta kanoner i vingarna. Den kan bära två 500lb i flygkroppsbombfacket som standardlast och ytterligare två 250lb bomber med överbelastningsvikt.

Flygplanet hade en W-formad vinge. Vingens mittpaneler hade en svept bakkant och rak bakkant, medan de yttre panelerna hade en rak framkant och svepte framåt bakkant. Vingarna hade slitsade metallbromsar på undersidan av de yttre panelerna.

Översikt över varianter

Produktionen av Vengeance indelades i tre huvudkategorier. Flygplan som tillverkats före utlåning leasades som V-72 i USA och Mk I (för flygplan som producerades av Northrop) och II (producerad av Vultee) av RAF.

Flygplan som tillverkats enligt samma standarder efter starten av låneavtalet fick USAAF-beteckningen A-31 och RAF-beteckningarna Mk IA (Northrop) och III (Vultee).

Flygplan som tillverkats med amerikansk utrustning och 0,50 tum kanoner fick den amerikanska beteckningen A-35 och RAF-beteckningen Mk IV.

Produktion Totalsumma

Beteckning

Företag

siffra

Anteckningar

Mk I

Northrop

200

Första och andra brittiska order

Mk IA/ A-31-NO

Northrop

200

4: e brittiska ordningen

Mk II

Vultee

500

1: a, 2: a och 3: e brittiska order

Mk III (A-31C)

Vultee

100

A-35A (V88)

Vultee

99

A-35B

Vultee

831

TOTAL

1,930

Förenta staterna Service V-72 Hämnd

Vultee V-72 var beteckningen som gavs till de förhandsutlånade leasingflygplan som togs över från brittiska order av USAAF efter det amerikanska inträdet i andra världskriget.

De fyra skvadronerna i 312: e bombardementsgruppen (386: e, 387: e, 388: e och 389: e bombarderingskvadronen) använde V-72 vid sidan av A-24 1942-43. Mellan december 1942 och februari 1943 flög gruppen ett antal patruller mot ubåtar,

311th Bombardment Group (Dive) använde V-72 medan den tränade i USA. Dess tre skvadroner var då kända som 382: e, 383: e och 384: e bombardementet. V-72s ersattes av A-36 och P-51 innan gruppen flyttade till Indien. Gruppen blev så småningom 311: e jaktgruppen och dess skvadroner den 528: e, 529: e och 530: e stridsskvadronen.

V-72 användes också under 1942 för träning av de fyra skvadronerna i den 84: e jaktgruppen (då den 84: e bombardementsgruppen). Liksom med 311: e utsågs dessa skvadroner initialt till 301: e, 302: e, 303: e och 304: e bombardementskvadronen, men blev den 496: e, 497: e, 498: e och 491: e stridseskadronen innan de gick in i strid).

Detsamma gällde 306: e bombardementet (senare 500: e fighter) och 308: e (502: e fighter) skvadronerna, båda en del av den 85: e bombardementsgruppen och 307: e bombardementet (501: e fighter), som ingår i den 345: e bombardementsgruppen.

Vultee Vengeance Mk I (modell 72)
Motor: Wright GR-2600-A5B-5 Cyklon
Effekt: 1700 hk
Besättning: 2
Vingbredd: 48 fot
Längd: 40 fot
Höjd: 12 fot 10 tum
Lastad vikt: 12 480 lb
Maxhastighet: 279 mph
Marschfart: 250mph
Servicetak: 24 300 fot
Räckvidd: 1200 mil
Beväpning: Fyra 0,30 tum kanoner i vingar och två 0,30 tum flexibelt monterade kanoner i bakre cockpit
Bomblast: 1500 kg


Vultee Vengeance - utveckling, översikt och amerikansk service - historia

Fallhistorik för motorprojektet R-2600
Sammanställt av Historiska kontoret,
Air Technical Service Command (Wright Field), januari 1945
Redigerad och omskriven av AEHS -medlemmen Jay Smith

Wright R-2600 (Wikimedia Commons)

& quotCase History of R-2600 Engine Project & quot dokumenterar problem med Wright R-2600 som är bekanta för dem som flyger bakom Lycomings och Continentals: cylinderkorrosion, kolvringslitage, överdriven oljeförbrukning. Den ursprungliga rapporten, liksom alla ATSC-fallhistorier, består av en sammanfattning (9 sidor), en sammanfattning (37 sidor) och en fil med underlag.

R-2600, designad och tillverkad av Wright Aeronautical Corporation, härstammar från företagets specifikation #439, 23 september 1936. Air Corps köpte en experimentmotor för $ 40 000 i oktober 1936. Air Corps Materiel Division testade motorn 10 mars till 24 maj 1936. Chefen för experimentell teknikavdelning på Wright Field rekommenderade sedan R-2600 som en godkänd motortyp. Behörighet för inköp #149860 tillhandahålls för 467 R-2600-3-motorer på kontrakt W535 AC-12061 för 4 857 582,70 dollar.

När kontraktet ingicks var R-2600 inte fullt utvecklad och gav stora besvär innan den blev en enastående motor. Det fanns så sent som i oktober 1943 fel på tillbehörsdrivna växlar, cylinderfel (orsakade av korroderade eller rostande fat), fel på kompressorn i kopplingsaggregatet och överdriven oljeförbrukning.

Ett av de tidigaste problemen var problem med förgasaren. Kalibreringen av en modelltestmotor i maj 1939 motortest fann att Stromberg PD -förgasaren var för liten. Wright Field begärde utvecklingen av en större. Motorn i R-2600-3-serien misslyckades med sitt 150-timmars typtest (juli 1939), till stor del på grund av PD-förgasaren: motorn lyckades inte utveckla 1350 BHP på 5 500 fot eller 1275 BHP vid 12 000 fot. Två andra förgasare prövades, Stromberg PD -12J1 och Holley 1685. En Holley -förgasare monterad på motorerna i modell -9 -serien löste slutligen problemet. Wright Aeronautical trodde att Holley -förgasaren (typ ospecificerad) skulle hjälpa & kvot att bota & hellipfel förgasningsfördelning och överhettning & problem. Överhettning var inte så botad.

Förgasarproblem orsakade R-2600-29 motorstörningar i A-20K-flygplan [1], vilket gjorde dem olämpliga för färjor, rapporterade British Air Commission oktober 1944. Holley HA-förgasare ersatte Holley HB-enheter, vilket möjliggjorde färja. Air Transport Command skulle inte färja B-25 till Hawaii av samma anledning. Installation av Holley HA -förgasare tillåten färja. Förgasarna (150) returnerades efter varje resa för återanvändning!

Cylindrar och oljeförbrukning

Andra svårlösta problem var slitage på kolv och kolvring och överdriven oljeförbrukning.

I augusti 1939 under testet misslyckades en 19-timmars testmotor: kolv nummer 2-cylinder brann igenom nära avgasventilen och ringar i cylindrarna 2, 5, 6 och 10 fastnade. Nya kolvar och avsmalnande ringar löste inte problemet. Marinprovning visade att första och andra ringarna var trasiga i nummer 2 -cylinder, den övre ringen i nummer 5 -cylindern gick sönder och fastnade, flera toppringar började fastna och flera andra och tredje ringar med avsmalnande slitna.

Tretton av trettiotre A-20B-flygplan [2] (för leverans till Oran, Afrika) landade någon annanstans i december 1942 på grund av trasiga och fastna kolvringar och hög oljeförbrukning.

Douglas A-20A
(Wikimedia Commons)

Liknande misslyckanden hände för andra flygplan som använde R-2600-motorn (B-17, A-31 [3] och A-35 [4]). Rapporter från Brasilien i januari 1943 uppgav att A-31: or som levererades till arméns flygvapens baser var mestadels "kommission" från förorenade tändstift och överdriven oljekonsumtion. Hög motortemperatur kan ha accelererat slitage på kolvringen.

Vultee A-31 Hämnd
(Australian War Memorial)

I mars 1943 undersökte en särskild kolvringskommitté dessa misslyckanden.

Under armémanövrer i Louisiana byttes sju av tjugosex motorer i A-20A-flygplan på grund av hög oljeförbrukning. RAF i juni 1943 rapporterade leveransförseningar i Mellanöstern för R-2600-drivna flygplan på grund av en "otillåten oljeförbrukning." U. S. Army Air Forces hade samma idé tidigare.

Cylinderrost och korrosion

Det mest irriterande problemet var rost och korrosion i cylindrarna. Korrosionskommittén, inrättad av CTI-1325 (17 maj 1943) skrev: "Vi vet inte svaret men börjar misstänka Gremlins." FBI kontrollerade sabotage. Den & quotepidemiska & quot; från december 1942 till mars 1943 var korrosion, och den från juni-juli 1943, rost.

Det tidigaste korrosionsbesväret kom den 15 december 1942 från Army Air Forces högkvarter i Nordafrika: många A-20-flygplan anlände & kvotera Accra i sådant skick att alla cylindrar måste bytas. & Quot & quot i den utsträckning ringen och cylinderns slitage accelererade bortom all rimlig serviceerfarenhet. & quot Orsaken kan ha varit flygplan kvar i flera veckor utan att motorer vänds eller "någon annan skyddande underhållstjänst." 27th Light Bombardment Group i Baton Rouge, Louisiana fann R -2600 cylindrar och kolvar från A-20-talet & quot dåligt urkärnade (korroderade) & quot, vilket kräver att alla motorer byts. Welleston, Atlanta och Memphis klagade på & quotrusty & quot -cylindrar. Pratt & amp; Whitney skyllde på fukt som applicerades på ståldelar under motormontering av icke älskade händer.

Wright Field & rsquos Aircraft Modification Section höll inte med. Korrosionen varierade från rost till svår grop som fjädrar ringarna. Utredare beslutade att detta berodde på & quot; särdrag som hände till installationen i A-20. Korrosionskommittén rekommenderade överensstämmelse med specifikation AN-C-80 som i stor utsträckning borde eliminera korrosion. Men rostproblemet blev allvarligt i juni 1943 General Chidlaw skrev (23 juli 1943) General Echols att korrosionsproblemet ännu inte var slickat. & Quot skrev. Utarmade lager av höglegerat stål, föreslogs det, nödvändigtgjorde byte av rostbenäget vanligt kolstål. Problemet blev allvarligare och FBI ombads i augusti att undersöka. FBI rapporterade 22 september 1943 ingen sabotage. Samtidigt meddelade Wright Fields Engineering Division 3 augusti 1943 att en blandning av 75% ny olja och 25% rostförebyggande förening löste problemet. Den 7 september 1943 angav en Memorandum Report att en modifierad bakelitlack skulle sprutas och bakas på alla ståldelar.

Andra problem dök upp under det tredje 150-timmarsmodelltestet i april 1940:

  • Motorn utvecklade inte tillverkarens nominella hästkrafter på höjd
  • Cylinderhållare har gått sönder
  • Växlar misslyckades
  • Olja läckte ut från oljetanken, förbi oljepumpen och in i motorn mer än ett kilo i timmen

Vid andra tester lossnade de insatta skruvarna som höll diffusorplattan mot kompressorns bakre hus och gick in i pumphjulet.

Kvalitetstester vid Power Plant Laboratory, Wright Field och Wright Aeronautical Corporation rekommenderade ändringar av R-2600-29-motorer (ersätter R-2600-13-motorer i B-25s):

  • Silverfärgade master-stavlager istället för koppar-blylager
  • Valsade gängcylinderskruvar i stället för slipade gängskruvar
  • Ett omdesignat höghastighetskopplingshus
  • Nya kopplingsplattor i lågfläktskopplingen
  • Mellanliggande pumphjulsdrivaxel

R-2600-31-motorn klarade sitt 150-timmars modelltest (Army-Navy Specification #9502-B) november 1943. Vissa delar visade & quotscratching, pitting or picking. & Quot Dessa ansågs inte vara allvarliga och den 26 januari, 1944 Wright Field & rsquos Power Plant Laboratory rekommenderade R-2600-31 för tillfredsställande slutförande av 150-timmars modellprov, med undantag för otillfredsställande slitage på kolvstift och mellanliggande pumphjulsaxelbussningar.

I november 1944 var det fel på reduktionsdrevsbussningar och kolvstifthållare i R-2600-B-motorer så allvarliga att Wright Aeronautical höll alla motorer [5]. Alla motorer som skickades efter den 25 oktober 1944 returnerades till Wright & rsquos Lockland-fabrik för kostnadsfritt byte av otillfredsställande delar. En godkänd designändring förväntades åtgärda dessa fel.

Skicka e -post till med frågor eller kommentarer om denna webbplats.
Denna webbplats är beroende av cookies för att den ska fungera. Om du fortsätter att surfa, bläddra, klicka eller på annat sätt interagera, ger du implicit bekräftelse och godkännande av detta.
Copyright & kopia 2002-2021 Aircraft Engine Historical Society, Inc.


Innehåll

Vultee lämnade ett förslag som svar på en US Army Air Corps begäran om en ovanlig konfiguration. Vultee-designen vann tävlingen och slog Curtiss XP-55 Ascender och Northrop XP-56 Black Bullet. Vultee utsåg den till modell 84, en ättling till deras tidigare modell 78. Efter att ha genomfört preliminära konstruktions- och vindtunneltester, tilldelades ett kontrakt för en prototyp den 8 januari 1941. En andra prototyp beställdes den 17 mars 1942. Även om det verkade vara en radikal design, prestanda var slarvig och projektet avbröts.

XP-54 konstruerades med en pådrivningsmotor i den bakre delen av flygkroppen. Svansen monterades bakåt mellan två mid-wing bommar, med den tolv fot långa propellen mellan dem. Designen inkluderade en "kanalad vingsektion" som utvecklats av NACA för att möjligen möjliggöra installation av kylradiatorer och intercoolers i den inverterade måsvingan. Pratt & amp; Whitney X-1800-motorn föreslogs som motor, men efter utvecklingen avbröts den. Den vätskekylda Lycoming XH-2470 ersattes.

I september 1941 ändrades XP-54-uppdraget från låghöjd till höghöjdsavlyssning. Följaktligen tillsattes en turbo-kompressor och tyngre rustning, och tomvikten ökade till 18 000 lb (5 200 till 8 200 kg).

XP-54 var unik på många sätt. Cockpiten under tryck krävde ett komplext inträdessystem: pilotsätet fungerade som en hiss för cockpitåtkomst från marken. Piloten sänkte sätet elektriskt, satte sig i det och lyfte upp det i sittbrunnen. Bail-out-proceduren komplicerades av trycksystemet, vilket krävde att piloten och sätet sänks nedåt för att rensa propellerbågen. [1] Näsdelen kan också svänga genom vertikalen, tre grader upp och sex grader nedåt. I näsan var två 37 mm T-9 kanoner i styva fästen medan två .50 kal maskingevär var i rörliga fästen. Rörelsen av näsan och maskingevärna styrdes av en speciell kompenserande pistolsikt. Således kan kanonbanan höjas utan att ändra flyginställningen för flygplanet. Den stora nässektionen gav upphov till dess nyckfulla smeknamn, Swoose Goose, inspirerad av en sång om Alexander som var halvsvan och halvgås: "Alexander var en swoose." -ett namn som delas med den äldsta överlevande B-17.

Flygtester av den första prototypen, 41-1210, började den 15 januari 1943. Försöken visade att prestanda var betydligt lägre än garantier. Samtidigt avbröts utvecklingen av XH-2470-motorn. Även om Allison V-3420-motorn kunde ersättas, krävde det betydande byten av flygplan. Beräknad försening och kostnader resulterade i ett beslut att inte överväga produktionsköp.

Prototyperna fortsatte att användas i ett experimentprogram tills problem med Lycoming -motorerna och brist på reservdelar orsakade uppsägning. Den andra prototypen, 42-108994 (men av misstag målad som 42-1211) utrustad med en experimentell GE -kompressor, gjorde tio flygningar innan den förflyttades till ett "delplan" för att hålla den första prototypen i luften. [2]


Vultee Vengeance - utveckling, översikt och amerikansk service - historia

+& pund 4,50 Storbritannien Leverans eller gratis leverans i Storbritannien om ordern är över & £ 35
(klicka här för internationella leveranspriser)

Beställ inom de närmaste 4 timmarna, 11 minuter för att få din beställning behandlad nästa arbetsdag!

Behöver du en valutaomvandlare? Kolla XE.com för livepriser

Denna bok beskriver den extraordinära stridskarriären för den amerikanskbyggda Vultee Vengeance dykbombaren i både Royal Air Force och Indian Air Force service under Burma-kampanjerna 1942-45. Detta enmotoriga helmetallflygplan beställdes av försörjningsministeriet under de mörkaste dagarna av andra världskriget när den dödliga tyska kombinationen av Junkers Ju.87 Stuka och Panzer tankstyrkor hade erövrat större delen av Europa i en kampanj som varade en bara några veckor och invasionen av Storbritannien ansågs överhängande.

RAF hade uppfunnit dyk-bombplanskonceptet 1917 men hade konsekvent avvisat det under mellankrigstiden med besattheten av kraftiga bombningar som dominerade officiellt tänkande nästan uteslutande. När hämnden anlände sökte en fortfarande motvillig RAF efter en precisionsbombare för att förhindra en upprepning av de japanska flottans attacker i Indiska oceanen och sex skvadroner inrättades för att motverka detta hot. Med japanerna på gränserna till Burma och Indien visade sig dessa flygplan, som inte längre behövs för den ursprungliga rollen, i särklass det mest exakta bombplan som drivits av britterna fram till den tiden.

De allierade arméerna på marken, inklusive Orde Wingate & rsquos Chindits, krävde att de skulle fortsätta att användas och ansåg dem vara viktiga, men förgäves, och 1945 hade alla ersatts. Deras prestationer har ignorerats, förfalskats eller föraktats sedan dess men här, från ögonvittneskonton och officiella register, är deras fullständiga och sanna historia.

En fascinerande titt på ett i stort sett förbises flygplan från andra världskriget. Full av omfattande data om skvadroner inklusive besättningarna och själva flygplanen. Peter Smiths forskningsnivå och det engagemang det måste ha tagit att skriva den här boken är mycket tydligt när du läser igenom den.

Läs hela recensionen här

Vintage Airfix

. det stora djupet och bredden av forskning och information i boken betyder att det är en fantastisk historia av typen.

Airfix Model World, maj 2020

Vultee Vengeance är ett av de mindre kända flygplanen i RAF -tjänst under andra världskriget. Denna dykbombare förvärvades från USA av den brittiska inköpskommissionen under krigets mörkaste dagar och spelade en viktig roll senare i Fjärran Östern till stöd för Chindits specialstyrkor - rekommenderas starkt

Med i

Royal Air Force Historical Society, Journal 72

Peter Smith har producerat ett anmärkningsvärt verk om Vultee Model 72, A-31, A-35 Vengeance dykbombare med titeln The Vultee Vengeance In Battle, utgiven av Pen & Sword. I de 8 kapitlen på 324 sidor täcker han flygplanets ursprung och utveckling, från Armee de l'Air -specifikationerna till de ständigt föränderliga RAF -kraven. Sex specifika stridskvadroner och deras verksamhet diskuteras i detalj. Jag hade inte insett hur exakt och effektiv denna 0 ° infallsvinkel var, och hur viktig dess service hade varit. Den här boken visar det sanna värdet av detta osunga flygplan. Det finns en karta över Fjärran Österns verksamhet och 32 foton tillsammans med text som täcker dess användning av IAF, RAF, RAAF, Free French, USAAF och Brazilian Air Force.

Japanese Aviation Society

Det står som en fantastisk forskning och ett passande svar på typens motståndare.

Läs hela recensionen här

Damien Burke, författare till TSR2 - Britain's Last Bomber

Fantastiskt detaljerad skriven text. Jag uppmanar dig att hämta detta.

Se hela videorecensionen här

Skalmodellering nu

Vultee Vengeance Crash Site

Denna plats har historisk betydelse. Den 17 augusti 1944 startade Vultee Vengeance från No 25 Squadron, Pearce, på en rutinflygning till Corrigin och återvände för att göra väderobservationer. Piloten var WO Jack Ingram och navigatören/observatören var flygsergeant Clyde Lennard King. Från Corrigan vände planet norrut men fastnade i tät molnbildning. Bränslesituationen blev kritisk. Från molnbrott placerades ett område med tät busk utan tecken på bostad. Piloten bestämde att han och navigatören skulle bala ut The Vultee Vengeance är ett besvärligt flygplan och måste rulla för att besättningen ska kunna bala ut. Ingram landade säkert men inga tecken på kung har någonsin hittats.
Ingram blev kvar där han hade landat till morgonen därpå när han begav sig västerut genom tät busk. När han kom till en bränd röjning stack han ut sin fallskärm. En chansanmärkning från en kommersiell flygbolagspilot ledde till att fallskärmen hittades 80 km öster om Narembeen. Detta gav RAAF en uppfattning om området för att söka efter de försvunna flygmännen. Efter att ha gått i två dagar nådde Ingram ett bondgård och lyftes i säkerhet.
En massiv sökning efter navigatörskungen startades. Det varade i veckor och involverade 30 flygplan, 500 sökare och supportteam, inklusive polis, monterade ryttare, civila och aboriginer. Inget tecken på kung hittades någonsin. De sönderrivna styckena av en fallskärm hittades 30 km från kraschplatsen. Senare gick en brand genom området som förstörde ytterligare bevis.
Flygplanets vrak täckte fyra hektar. Motorn var inbäddad tre meter i marken. Man tror att delar av det senare användes för att återställa en annan Vultee Vengeance på Air Force Museum. Yilgarn Shire har rest ett monument på platsen.

Fysisk beskrivning

94 km söder om Southern Cross på vägen till Hyden är King-Ingram Road. Detta leder till platsen för kraschen av en RAAF Vultee Vengeance dykbombare och det olösta mysteriet om vad som hände med navigatorn. Mycket få rester av planet - endast små bitar av metall och bevis på markstörningar.


Vultee Vengeance - utveckling, översikt och amerikansk service - historia

Figur 50. Grumman FM-2 Wildcat.

Bild 51. Douglas A-24B Invader.

[23]. var av kort varaktighet i syfte att få information om problem med ett specifikt flygplan. Samlingen av efterkrigsflygplan visas i figurerna 54-63.

Utvärderingar av stabilitet och kontroll och flygkvaliteter utfördes på ett antal högpresterande propeller- och jetflygplan, inklusive XBT2D-1 (Skyraider-prototyp), F6U-1 Pirate, F7F-3 Tigercat, F8F-1 Bearcat, F-84C Thunderjet, F-84F-5-RE Thunderstreak och F5D-1 Skylancer. F8F-1 användes också för att undersöka buffé, inklusive tester med propellern fjädrad och avstängd motor så att det aerodynamiska bidraget kunde identifieras. F-86A Sabre genomgick stall- och centrifugeringstest. Prototypen för Boeing 707 kommersiella jettransport, 367-80, användes för att utveckla kriterier för flygkvaliteter som hänför sig till stora flygplanskonstruktioner. Det programmet kördes av Hervey Quigley.

Flera specialiserade tester utfördes för olika ändamål. I denna kategori visade F-100C T-ALCS ett normalt accelerationskommandokontrollsystem. T-33A-5 Shooting Star utförde noll-g-flygningar och användes för pilotfysiologiska studier. Baklastprov utfördes på XR60-1-konstitutionen. Slutligen användes L-4 Cub vid utvärderingar av ett gjutlandningsredskap för start med 90 graders sidvind. Det senare var ett av Bill McAvoys sista testprogram.

Två studier utfördes på B-47 Stratojet, en avseende mätning och förutsägelse av svarsegenskaper hos ett flexibelt flygplan till hissstyrning (ref. 43), den andra om experimentella och förutspådda längsgående och sidoriktade svarskarakteristika för en svept- vingflygplan (ref. 44). Resultaten gav en indikation på den detalj som krävs i analysmodellerna för att på ett adekvat sätt förutsäga flygplanets aeroelastiska beteende. Dessa studier utfördes av Henry Cole och Stuart Brown och utfördes tillsammans med NASA High Speed ​​Flight Station. Alla flygningar för båda programmen genomfördes på Edwards Air Force Base.

Dessa fokuserade testprogram tjänade ett användbart syfte för tillverkarna och militären att lösa problem med de olika konstruktionerna. Tillsammans med dem genomfördes mer bestående insatser på Ames som hade en bredare inverkan på tekniken. I ett fall användes tester i 7- till 10-fots vindtunneln för att utveckla förutsägelser om flygkvaliteter, särskilt angående påverkan av propellerns slipstream-effekter på stabilitet och kontroll. Harry Goett, Roy Jackson och Steve Belsley publicerade den sammanfattande rapporten om detta arbete (ref. 45), som startade flygtester med ett antal flygplan, mest omfattande med marinens tvåmotoriga patrullflygplan, PV-1, och lånade ut trovärdighet för förutsägelsemetoderna (ref. 46 och 47). Flygen visade att vindtunnelresultaten förväntade sig de otillfredsställande längsgående egenskaper som tillskrivs höga kontrollkrafter vid manövrar och landningar. Effekteffekter bekräftades vara viktiga bidrag. De höga rotor- och roderkrafterna, som påverkade rullnings- och motorriktningskontrollen negativt, styrktes också. Exempel på resultat från andra program som arbetade sig in i militärens flygkvalitetsdesignspecifikationer framgår av referenser 48-57.

År 1947 tilldelades Octave Chanute -priset till Larry Clousing som ett erkännande av hans bidrag till utvärderingar av flygkvaliteter av ett antal av de tidiga flygplanen och för hans arbete med aerodynamiska experiment.

Figur 52. Chance Vought F4U-4 Corsair.

Figur 55. Douglas XBT2D-1 (Skyraider-prototyp).

Figur 56. Grumman F8F-1 Bearcat.

Bild 57. Taylorcraft L-4 Cub med Seth Anderson.

Bild 58. Nordamerikansk F-86A Sabre.

Figur 59. Lockheed XR60-1 Constitution.

Figur 60. Vought F6U-1 Pirate.

Figur 61. Republic F-84F-5-RE Åska.

Figur 62. Vought F7U-3 Cutlass.

Figur 63. Boeing 367-80 (prototyp för 707 jettransport).

Figur 64. Mirror landningshjälp vid Crows Landing, Kalifornien.

Som en konsekvens av sitt långa engagemang i bedömningar av flygkvaliteter av en mängd olika flygplan uppmanades Ames för specifika projekt som oroade militärtjänsterna. Ett särskilt program sticker ut i detta avseende. I mitten av 1950-talet var marinen avsedd att fastställa inflytande av flygkvaliteter på minsta acceptabla inflygningshastighet för landning på ett hangarfartyg och vände sig till Ames för att genomföra programmet. Denna insats, ledd av Maurie White, involverade utvärdering av 10 flygplan i 41 olika konfigurationer. Marinen skickade olika flygplan varannan månad till Ames för att instrumenteras och flyga i det programmet, 19 inklusive F4D-1, F7U-3 och F9F-6 dessutom FJ-3 och F9F-4, som också var inblandade i gränsskiktskontrollforskning, användes också. Tillsammans med dessa fem flög Ames fem flygvapenflygplan för att bredda provet, inklusive F-84F-5-RE, F-86 E och F, F-94C och F-100A. Konfigurationsvariationer inkluderade klafftyp och inställning, vingkonfiguration och flödeskontrollenheter och gränsskiktskontrollsystem. I det experimentet erhölls omfattande pilotmeningsdata om stabiliteten och kontrollegenskaperna som påverkade den acceptabla infartshastigheten. Den efterföljande rapporten (ref. 58) inkluderade jämförelser med befintliga urvalskriterier för tillvägagångssätt.

De flesta flygningarna genomfördes av George Cooper, Bob Innis och Fred Drinkwater och ägde rum på den avlägsna testplatsen vid Crows Landing Naval Auxiliary Landing Field i det centrala dalområdet öster om Moffett Field. Figur 64 visar spegellandningshjälpen intill Crows Landing -banan som användes för inflygningsguide. Detta program var ett av de tidigaste där markbaserad simulering började spela en kompletterande roll med flygprov vid bedömning av flygkvaliteter. White och Drinkwater genomförde en studie av effekterna på val av infartshastighet med hjälp av den mest rudimentära enheten. Representationen av den yttre visuella scenen tillhandahålls av ett katodstrålerör, som presenterade en artificiell horisont och en kontur av bärardäcket. En voltmeter fungerade som lufthastighetsindikator. Gasreglage och mittknappsregleringar tillhandahålls, den senare med fasta fjäderstöd, med piloten som sitter framför partiet på en svängbar pall. Allt var kopplat via en analog dator som utförde beräkningen av flygplanets dynamiska svar. Resultaten som erhölls hjälpte dock till att generalisera resultaten som erhölls under flygning, och de två gav tillsammans en tydlig indikation på det bästa valet för önskad inflygningshastighet. Vid höjdpunkten av dessa aktiviteter presenterade Drinkwater, Cooper och Innis alla sina synpunkter på ämnet i referens 59 och 60, med Innis som introducerade en STOL-transport, YC-134A, till samlingen av undersökta krigare. Dessa tre män, tillsammans med de andra medlemmarna av forskarpilotpersonalen som de framkom 1955, visas i figur 65.

Another extensive flying qualities investigation that involved an early simulator and a number of airplanes was Brent Creer's study of lateral control requirements. This was carried out on the F6F, F-86, F4D, T-37, F-100, and the P-80A. It also used the pitch-roll chair simulator, a new device with two rotational degrees of freedom, dubbed the NE2 for "any two" axes of motion. This study screened several candidate.

Figure 65 . Flight Operations Branch circa 1955. From left to right: Bob Innis, Don Heinle, Larry Clousing, Bill McAvoy, Fred Drinkwater, George Cooper.

. flying quality parameters and showed where motion simulation proved of value in the process (ref. 61).

In concluding this section, it is appropriate to highlight what may be the most important contribution of the flying qualities evaluation programs and experiments conducted on the variable stability aircraft at Ames. This, of course, was George Cooper's standardized system for rating an aircraft's flying qualities. Cooper developed his rating system over several years as a result of the need to quantify the pilot's judgment of an aircraft's handling in a fashion that could be used in the stability and control design process. This came about because of his perception of the value that such a system would have, and because of the encouragement of his colleagues in this country and in England who were familiar with his initial attempts. Characteristically, Harry Goett spurred Cooper on in pursuit of this objective.

Cooper's approach forced a specific definition of the pilot's task and of its performance standards. Further, it accounted for the demands the aircraft placed on the pilot in accomplishing a given task to some specified degree of precision. The Cooper Pilot Opinion Rating Scale was initially published in 1957 (ref. 62). After several [ 27 ] years of experience gained in its application to many flight and simulator experiments and through its use by the military services and aircraft industry, it was subsequently modified in collaboration with Robert (Bob) Harper of the Cornell Aeronautical Laboratory and became the Cooper-Harper Handling Qualities Rating Scale (fig. 66) in 1969 (ref. 63). This rating scale has been one of the enduring contributions of flying qualities research at Ames over the past 40 years the scale remains as the standard way of measuring flying qualities to this day. In recognition of his many contributions to aviation safety, Cooper received the Adm. Luis de Florez Flight Safety Award in 1966 and the Richard Hansford Burroughs, Jr., Test Pilot Award in 1971. After he retired, both he and Bob Harper were selected by the American Institute of Aeronautics and Astronautics to reprise the Cooper-Harper Rating Scale in the 1984 Wright Brothers Lectureship in Aeronautics.

Figure 66 . Cooper-Harper Handling Qualities Rating Scale.

15. Harry Goett and Bill Harper 1998: personal communication. 16. Seth Anderson 1998: personal communication. 17. George Cooper 1998: personal communication. 18. Ron Gerdes 1998: personal communication. 19. George Cooper 1998: personal communication.


Crusading as an Act of Vengeance, 1095-1216

‘I am the Lord thy God, mighty, jealous, visiting the iniquity of the fathers upon the children, unto the third and fourth generation of them that hate me: And showing mercy unto thousands to them that love me, and keep my commandments’ (Ex. 20:5–6). Medieval crusaders, argues Susanna A. Throop in Crusading as an Act of Vengeance, viewed the biblical notion of the Lord’s vengeance with deadly earnestness and interpreted their own actions through the ‘vocabulary of vengeance’. In this book, based on her University of Cambridge dissertation, Throop seeks to dislodge the widely accepted position among crusade historians (in part, due to the magisterial work of her former advisor, Jonathan Riley-Smith) that the idea of crusading as an act of vengeance represented a largely secular phenomenon, developing among the ‘rude’ laity, one that peaked around the time of the First Crusade only to disappear as later generations of clerical authors refined the theology of crusading. Throop, to the contrary, declares that an interpretation of crusading as vengeance inhabited a vital place in the clerical as well as the lay imaginations, and that far from fading over the course of the 12th and early 13th centuries, the notion occupied an increasingly prominent place in crusade histories, chansons de geste, letters, poems, and other sources. Along the way, she makes a number of intriguing observations about the nature of religious violence and the place of crusading within medieval Christian ‘mytho-history’, suggesting some of the wider possibilities raised by her close reading of the vocabulary of vengeance and related terms.

As noted by Throop, Carl Erdman, in his highly influential 1935 work The Origin of the Idea of Crusading, judged the idea of crusading as an act of vengeance to be ‘an obvious improvisation suggestive of how immature the idea of crusading still was’.(1) Erdmann, followed by other scholars including Riley-Smith, Peter Partner, Jean Flori and others, associated this ‘immature’ idea squarely with the laity, part of their ‘feudal’ notions of honor, shame, and military obligation. Throop takes issue with this interpretation of the evidence. ‘The concept of crusading as vengeance’, she declares, ‘was no anomaly, and crusading was conceived as an act of vengeance not only through the application of ‘secular’ values, but also through values inherent in twelfth-century Christianity’ (p. 9). Or, as she puts it elsewhere: ‘Text after text suggests that it would be inaccurate to envision a heavy ideological dividing line separating a pro-vengeance laity from an anti-vengeance Church’ (p. 31). She seems to feel that by skirting the idea of crusading as vengeance, or writing it off as a product of ‘unlettered’ minds, historians have left medieval churchmen off the hook for their articulation of crusading not just as an act of love (in the famous formulation of Riley-Smith), but also as an act of hatred – hatred and a desire for revenge against Jews, Muslims, and heretics, those who crucified Christ, seized the place of his self-sacrifice, or denied his divinity.(2) Crusade studies, she observes, have focused on crusading as an act of ‘pilgrimage, penitential warfare, just war, holy war, the defense of the Church, liberation, Christian love, and the imitation of Christ’, approaches that attempt to reconcile modern ‘Christian values’ with bloody reality of crusading.(3) Examining crusading as an act of vengeance requires us to move a ‘step further’ down that road, to grasp how medieval Christians could see their faith as calling for them to take violent revenge against enemies of their community.

The stakes are large in this issue, complicated by modern assumptions about religious belief, violence, and the meaning of vengeance. Throop, to avoid the dangers of anachronism, cautiously limits her approach and methods by focusing on a set of ‘signposts,’ terms that she claims as having an equivalency to the modern English word ‘vengeance’ – vindicta, ultio, och venjance. She offers a working definition of what these words meant, and what ‘vengeance’ effectively means throughout her monograph: ‘violence (both physical and nonphysical) driven by a sense of moral authority, and in certain cases divine approbation, against those who are believed to question that authority and/or approbation’ (p. 12). Her reading of sources for the First Crusade and its aftermath, divided into ‘eye-witness’ and ‘non-participant’ accounts (a traditional division that some scholars are starting to question in terms of its value for historical analysis) leads her to conclude that the notion of crusading as vengeance was not nearly as widespread as modern scholars often assume in the ‘early years’ of crusading. This position, one should note, leaves her at odds with historiography on the anti-Jewish pogroms in the Rhineland during the First Crusade, often understood as the most clear-cut example of crusading as revenge, in this case against the Jews for killing Christ (pp. 64–70). Rather, she argues, through the writings of both crusaders and those who never went on crusade (monastic authors, in particular), the idea of crusading as an act of vengeance developed over time, increasing rather than decreasing as the 12th century progressed.

Her understanding of crusading as vengeance does not lead her to discount the idea of crusading as an act of love: to the contrary, Christian love (caritas) for one’s neighbor could fuel the desire for revenge against Muslims and others (p. 62). Indeed, these sort of uncomfortable pairings (uncomfortable, that is, for modern sensibilities) form an important component of her research. Later in the book, she examines the related term of zelus, ‘zeal’ for Christianity, for God, or for justice, as a ‘catalyst’ for the idea of crusading as an act of vengeance, tying together ‘love of God, anger at sin, a passion for justice, and the vocabulary of vengeance’ (p. 170). Through her careful exploration of that vocabulary, Throop concludes that there were wide-ranging, pre-existing ‘patterns of thought linking religion, emotion, and violence’ that offered ‘powerful motivating tools at the disposal of those who encouraged the crusading movement and sought a united Christendom, internally reformed and externally expanding’ (p. 169). Simply put, crusading as an act of vengeance made powerful sense for 12th- and 13th-century Christians, both lay and clerical, accounting for its appeal and increasing prominence.

Throop’s handling of her terms – primarily vindicta, ultio, venjance, och zelus – is convincing, although at points, her trawling of the sources that include those terms casts a rather indiscriminate net to yield her particular catch: In a few short pages, analyzing links of justice and vengeance, she quickly ranges from Thomas of Chobham to William of Tyre, to Robert of Clari and James of Vitry, and then to Gratian and Bernard of Clairvaux (pp. 16–19) or, in a single paragraph on zeal and anger, she jump centuries from Hincmar of Rheims to Thomas of Chobham without really alerting the reader to the differences in their historical context (p. 158). The repeated marshalling of anecdotes and pastiche of references for her vocabulary of vengeance makes for some odd moments, such as when the exact same passage from the 12th-century crusader account of the siege of Lisbon, De expugnatione Lyxbonensi, is used on consecutive pages, to make similar points, apparently without cognizance of each other (pp. 106–7). Some readers might wish that she spent more time situating her various texts and authors, locating their notions of vengeance within the broader frame of their particular time and place. That said, Throop is quite explicit that her ‘deliberate goal has been to identify broad cultural themes, rather than individual proclivities’ (p. 8). Her search for vengeance through her terms also anchors her attempt to avoid anachronistic interpretations of vengeance colored by modern emotions and value-judgments. As she notes in her introduction: ‘It is worth repeating that I have not myself interpreted events as being ‘vengeful’ or ‘acts of vengeance’ (p. 6). The sources, she implies, speak for themselves. Of course, as Throop no doubt realizes, sources never speak for themselves, even when the modern historian conscientiously tries to avoid warping his or her evidence through anachronism. On the positive side, her caution avoids projecting modern notions of vengeance back into the past. The price paid for this approach, however, is a sometimes limited scope of historical analysis, heavy on the parsing of terms, without the rewarding pay-off that pushes beyond the parts to grasp a greater whole. At points, one wishes that Throop hade taken a little more interpretative risk, making scholarly calls about the significance of vengeance, even when the precise terminology she highlights is not present.

Nevertheless, at some tantalizing points, Throop’s analysis of vengeance leads to some insightful claims about the relationship between crusading, vengeance, and memory, with a specific eye toward the relationship between Christianity and Islam. Divine vengeance, she rightly observes, struck sinners, including Christians themselves when they violated God’s laws. Both Christians and Muslims, by this logic, operated within the same redemptive and retributive economy of salvation, suggesting that ‘Muslims were not the others, but rather those of us who are doing wrong’ (p. 56 emphasis is her own). This is a striking claim that deserves more consideration. In the Book of Exodus, for example, God punishes the Egyptians without any suggestion that they were also his ‘Chosen People,’ only doing wrong. At the same time, undoubtedly, Throop captures something important about medieval Christian theology of history, in the sense that its inclusive universalism always sits paradoxically alongside self-definition through exclusion. The ambivalent relationship between Judaism and Christian offered a particularly fraught example of this tension, but a similar problem inhabited the Christian sense of Muslims as providential actors in salvation history: were Muslims to be killed or converted? Damned or saved? Were they pagans or a derivative of Christian heresy?

As Throop also observes, vengeance happens because it forms part of a story. As a ‘reaction to a prior event (real or imagined),’ she observes, ‘vengeance was always embedded in a chronological context’ (p. 13). For an individual such as a feudal lord, that event might fit into a personal narrative of violation, anger, and revenge (à la Stephen White, Richard Barton, and Daniel Smail). Within the context of crusading, however, the chronological context for vengeance reaches the level of what Throop (following Riley-Smith) calls ‘mytho-history,’ the ‘narrative framework underlying contemporary culture in the Christian West that assigned meaning and order to historical events on the basis of religious belief’ (pp. 101–2). The sweep of biblical history, including the crucifixion, the sack of Jerusalem by Roman armies under Titus and Vespasian, the Islamic conquest of the holy places thereby intersected with the ideology of crusading as an act of vengeance. This meta-narrative, including the ‘common theme of creating a world united by ‘true’ Christian faith through the means of just war and conversion’ (p. 135), meant that the medieval Latin theological imagination could assign the bloodiest of crusaders a moral purpose in God’s plan for history. Indeed, considering her claim that vengeance equally involved clerical thinkers, not just the laity, one might have expected to see even more about the importance of the Bible, exegesis, and Latin historical thinking for notions of vengeance. As Throop herself notes, much of Philippe Buc’s current work is wrestling with precisely this sort of ‘exegetical perspective,’ yielding considerable insights into the ‘relationship between Christian sacred texts and the concept of vengeance’ (p. 192).

At moments, therefore, Throop does throw some ‘big questions’ into the mix about religion, emotion, violence, history, and memory, set within the context of the dynamic 12th century. In her conclusion, she looks forward to a wider-ranging synthesis that might situate her own topic of crusading as vengeance within broader parameters. As she observes:

The last century of scholarship have seen the emergence of the twelfth-century ‘renaissance,’ ‘reformation,’ ‘revolution,’ and, most recently, ‘crisis.’ As it happens, the chronology of the development of the idea of crusading as vengeance coincided with a historical period of great intellectual regeneration, religious reformation, increasing Church power, shifting political structures, and increasing violent persecution. No one yet, to my knowledge, has worked to integrate the overall historiography of the twelfth-century with our evolving understanding of twelfth-century crusading (pp. 184–5).

This is a desirable goal, and whether Throop undertakes this task herself, or leaves it to others, in Crusading as an Act of Vengeance, she has done a valuable service to scholars who wish to tackle the crusades and the dilemma of religious violence.


Shia Islam

With the death of Husayn, Muhammad's grandson, in Karbala, the first attempt to put an Alid (a descendant of Ali) in control over the Islamic empire had failed. Their supporters continued to challenge the Umayyads who had emerged victorious and succeeded in gaining power over the entire Islamic world. Ali's cause did not come first for all supporters of these rebellions. Many had other reasons for opposing the Umayyads, such as the Umayyad favoritism for their family, Syria, and the Arabs the Alids offered the most obvious alternative.

Kufa in particular became a center for resistance. The historian Heinz Halm sees the beginnings of Shiism as a religious community in this region in the 680s when a movement of 'penitents' (Arabic: tawwabun) appeared who demanded revenge for Husayn and wanted to atone with swords in their hands for having let him down.Initially a movement of a small number of elderly men, it turned into a rebellion with broader support, but it was crushed by the Umayyads in 685. Eventually this public display of solidarity and grief would become a distinctive feature of Shiite public religiosity.

Iraq during the formative period is also the backdrop against which Shiism developed one of its most distinctive features, the concept of the Hidden Imam. Unlike Sunni Islam, where the term imam commonly denotes the leader of prayer, in Shiism the Imam is a descendant of Ali and seen as the politico-religious leader of the entire community. A line of historical figures who were highly respected scholars and later identified as Imams was put on hold when one of them (Shiite sects disagree about the point in the line where this took place) went into Occultation (hiding). One of the aspects of this crucial figure is its apocalyptic character. For many Shiites, the Hidden Imam is the Mahdi who appears at the end of time and restores justice. He is also referred to as al-Qaim, 'he who arises'. Sometimes a difference is made between mahdis who temporarily restore justice and the Mahdi-Qaim who ushers in the final period of grace.

While Sunnis share the belief in such a figure (although he is not expected to take revenge for the injustice the Shiites suffered), the appearance of mahdis as leaders of political movements is usually associated with Shiism, although the leaders were not necessarily Shiites. The rebellion of the Sudanese Mahdi against the Turco-Egyptian government in the 1880s is a well-known example of a Sunni Mahdi. In post-invasion Iraq, one of the most powerful forces in the country is called the Mahdi army (led by the Shiite Moktada al-Sadr). The Mahdi is also mentioned in the constitution of the Islamic Republic of Iran. The earliest attested case in Islamic history in which Mahdism played such a role is the rebellion of Mukhtar in Kufa.

In 685, Mukhtar, an Arab, had started his rebellion in the name of Muhammad ibn al-Hanafiyya who, Mukhtar claimed, was the Mahdi. Ibn al-Hanafiyya dissociated himself from the revolt. It is noteworthy that though he was a son of Ali, his mother was not Fatima, but rather a slave. Unlike the men who became later the Shiite Imams, he was thus not a descendant of Muhammad, which indicates an early tendency to highlight Ali as an ancestor rather than Muhammad.

One of Mukhtar's slogans was vengeance for Husayn. He challenged not only the Umayyad caliph Abd Malik, who had only just succeeded to the throne, but also his strong rival Abdallah ibn al-Zubayr in Mecca, who claimed the caliphate for himself. Supporters of Mukhtar included the population of Kufa, who might have felt guilty for having denied Husayn their support, as well as non-Arab converts to Islam. In 687, the rebellion was suppressed by the troops of Ibn al-Zubayr. In the aftermath of these events and the death of Ibn al-Hanafiyya in 700, supporters of the Alids continued to pin their hopes on this elusive Mahdi, who, they claimed, was hiding in a cave only to return and fill the world with justice. In the following years similar stories were told about other leaders of rebellions. The belief in a redeemer hiding either in the material world or a remote metaphysical sphere became one of the most characteristic features of Shiism, although it is not key to the beliefs of many modern Shiites.


J.G. Brill Company

The J.G. Brill Company became a leader in the streetcar industry for its development and construction of lightweight and inexpensive cars.

Like most car builders such as the St. Louis Car Company and Cincinnati Car Company, Brill focused mostly on streetcar designs and less so on interurban equipment due to the fact that there was a larger market for the former.

The company's history dated back to the industry's infancy in 1860s when horses were still the primary means of motive power, hauling carriages through dirt or muddy streets.

While Brill got its start building horse-drawn streetcars and was poised to reap the profits from the electrified street railway boom in the late 19th century and began building heavier and longer equipment to match.

It also constructed passenger equipment for main line railroads and even buses in later years. As the industry declined in the 1920s and 1930s, so did the J.G. Slätvar. After various mergers the company finally disappeared altogether in 1954.

Philadelphia Suburban Transportation Company "Brilliner" #206 hustles past the former Philadelphia & Western shops in Upper Darby, Pennsylvania on September 2, 1965. This scene was taken from the Victory Avenue overpass. Roger Puta photo.

The history of the J.G. Brill began in 1869, in Philadelphia, when John George Brill and son George opened the J.G. Brill & Company to accommodate the growing streetcar systems popping up around the country.

John had a somewhat extensive background in the industry even at this time as he had built early streetcars for the W.C. Allison & Sons Company.

As mentioned above, at the time these operations were very small, serving mostly small to medium-sized towns, and operating with horse or mule power.


V-2 rocket

Våra redaktörer kommer att granska vad du har skickat in och avgöra om artikeln ska revideras.

V-2 rocket, German in full Vergeltungswaffen-2 (“Vengeance Weapon 2”), även kallad V-2 missile or A-4, German ballistic missile of World War II, the forerunner of modern space rockets and long-range missiles.

Developed in Germany from 1936 through the efforts of scientists led by Wernher von Braun, it was first successfully launched on October 3, 1942, and was fired against Paris on September 6, 1944. Two days later the first of more than 1,100 V-2s was fired against Great Britain (the last on March 27, 1945). Belgium was also heavily bombarded. About 5,000 people died in V-2 attacks, and it is estimated that at least 10,000 prisoners from the Mittelbau-Dora concentration camp died when used as forced labour in building V-2s at the underground Mittelwerk factory. After the war, both the United States and the Soviet Union captured large numbers of V-2s and used them in research that led to the development of their missile and space exploration programs.

The V-2 was 14 metres (47 feet) long, weighed 12,700–13,200 kg (28,000–29,000 pounds) at launching, and developed about 60,000 pounds of thrust, burning alcohol and liquid oxygen. The payload was about 725 kg (1,600 pounds) of high explosive, horizontal range was about 320 km (200 miles), and the peak altitude usually reached was roughly 80 km (50 miles). However, on June 20, 1944, a V-2 reached an altitude of 175 km (109 miles), making it the first rocket to reach space. Se även rockets and missile systems: The V-2. For contemporary accounts of V-2 bombings of London as recorded in the Britannica Book of the Year, ser BTW: London Classics: London in World War II.


INTRODUCTIONWhat is a personal network and how does it help me in my personal performance?How can I develop one effectively?What kind of people do I need to include in my network?What characteristics do I need to run a network?Are there any .

Författare: Sapiens Editorial

Publisher: Sapiens Editorial

INTRODUCTIONWhat is a personal network and how does it help me in my personal performance?How can I develop one effectively?What kind of people do I need to include in my network?What characteristics do I need to run a network?Are there any plans that help me achieve the goals I have in mind?WHAT WILL YOU LEARN?This text points out the importance of personal networks to achieve a successful professional career, as well as the characteristics they must have: loyalty and generosity among members, thinking about helping members rather than oneself and having some "superconnector" members. For their part, the networker must be a sociable and patient person, they must have a personal brand with a unique message to accompany that brand.In addition, given that the ultimate goal is to have a successful career, we touch on the goals and the reasons why we establish them. Following this theme, the author proposes a Network Action Plan, which will help us to follow a series of activities that will help us achieve the objectives we want.In the same way, it is emphasized that individuals should not forget their passion, but rather we should find a way to combine them with our activities to achieve a professional career with which we are satisfied.ABOUT THE ORIGINAL BOOKThe main theme of this book is the importance of personal networks on the road to success. Throughout this text, you will find suggestions that will help you develop your network.In addition, the author will propose the structure of a plan that allows us to work intelligently to meet our objectives.Finally, the necessary elements will be established so that each individual develops their own personal brand.ABOUT KEITH FERRAZZI: THE AUTHOR OF THE ORIGINAL BOOKFrom humble origins, Keith Ferrazzi began his professional life by applying the principles he shares in this book: creating a social network that would allow him to help other people. This process allowed him to develop and master the tools to develop this type of organization. Currently, he is a successful businessman and is considered to be an expert in the field of marketing. This book is based on the beliefs of Ferrazzi, who maintains that generosity is the basic pillar of a successful career.Throughout his text, we will find tips and the structure that the author himself followed to become the successful man he is today.

Not just a warranty , but a written performance guarantee . The only one in the
industry . When you buy the SuperConnector , the SuperWarranty comes with it ,
for no additional charge . We tell you what you can expect and guarantee that
you .


Titta på videon: ESCI 1:72 M-12 Gun Carriage. Frog 1:72 Vultee Vengeance